missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nucleostemin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38325
This item is not returnable.
View return policy
Description
Nucleostemin Polyclonal specifically detects Nucleostemin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Nucleostemin | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q9BVP2 | |
| GNL3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE | |
| 0.1 mL | |
| Apoptosis, Cellular Markers, Chromatin Modifiers, Core ESC Like Genes, Embryonic Stem Cell Markers, Epigenetics, Histones and Modified Histones, Metabotropic Glutamate Receptors, microRNA, mTOR Pathway, Neurofilaments, Stem Cell Markers, Stem Cell Signaling Pathway | |
| 26354 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C77032, E2IG3NNP47, estradiol-induced nucleotide binding protein, guanine nucleotide binding protein-like 3 (nucleolar), guanine nucleotide-binding protein-like 3, MGC800, Novel nucleolar protein 47, NSE2-induced gene 3 protein, Nucleolar GTP-binding protein 3, nucleostemin | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction