missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nucleostemin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 529.00
Specifications
| Antigen | Nucleostemin |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18674256
|
Novus Biologicals
NBP2-38325-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18186547
|
Novus Biologicals
NBP2-38325 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Nucleostemin Polyclonal specifically detects Nucleostemin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Nucleostemin | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cellular Markers, Chromatin Modifiers, Core ESC Like Genes, Embryonic Stem Cell Markers, Epigenetics, Histones and Modified Histones, Metabotropic Glutamate Receptors, microRNA, mTOR Pathway, Neurofilaments, Stem Cell Markers, Stem Cell Signaling Pathway | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C77032, E2IG3NNP47, estradiol-induced nucleotide binding protein, guanine nucleotide binding protein-like 3 (nucleolar), guanine nucleotide-binding protein-like 3, MGC800, Novel nucleolar protein 47, NSE2-induced gene 3 protein, Nucleolar GTP-binding protein 3, nucleostemin | |
| GNL3 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9BVP2 | |
| 26354 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title