missing translation for 'onlineSavingsMsg'
Learn More
Learn More
![NUDT19 Antibody [Unconjugated], Novus Biologicals 100 μL; Unconjugated:Antibodies,](https://assets.fishersci.com/TFS-Assets/CCG/Novus-Biologicals/antibodies/nbp3-43687_rabbit-nudt19-pab-24120251553255.jpg-650.jpg)
NUDT19 Antibody [Unconjugated], Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-43687-100ul
This item is not returnable.
View return policy
Description
NUDT19 Polyclonal antibody specifically detects NUDT19 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| NUDT19 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| EC 3.6.1, Nucleoside Diphosphate-Linked Moiety X Motif 19, Mitochondrial, Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 19, Nudix Motif 19, RP2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QDPRHFLRLCAHLDCTPDIWALHNWSAWLTPFLRGTTRRFDTAFFLCCLREPPPVYPDLAEVV | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 390916 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?