missing translation for 'onlineSavingsMsg'
Learn More
Learn More
![NUDT19 Antibody [Unconjugated], Novus Biologicals 100 μL; Unconjugated:Antibodies,](https://assets.fishersci.com/TFS-Assets/CCG/Novus-Biologicals/antibodies/nbp3-43687_rabbit-nudt19-pab-24120251553255.jpg-650.jpg)
NUDT19 Antibody [Unconjugated], Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-43687-100ul
This item is not returnable.
View return policy
Description
NUDT19 Polyclonal antibody specifically detects NUDT19 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| NUDT19 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| EC 3.6.1, Nucleoside Diphosphate-Linked Moiety X Motif 19, Mitochondrial, Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 19, Nudix Motif 19, RP2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QDPRHFLRLCAHLDCTPDIWALHNWSAWLTPFLRGTTRRFDTAFFLCCLREPPPVYPDLAEVV | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 390916 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu