missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUDT19 Antibody [Unconjugated], Novus Biologicals™
Rabbit Polyclonal Antibody
€ 422.00 - € 663.00
Specifications
| Antigen | NUDT19 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30279734
|
Novus Biologicals
NBP3-43687-100ul |
100 μL |
€ 663.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30279761
|
Novus Biologicals
NBP3-43687-25ul |
25 μL |
€ 422.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NUDT19 Polyclonal antibody specifically detects NUDT19 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| NUDT19 | |
| Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 3.6.1, Nucleoside Diphosphate-Linked Moiety X Motif 19, Mitochondrial, Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 19, Nudix Motif 19, RP2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QDPRHFLRLCAHLDCTPDIWALHNWSAWLTPFLRGTTRRFDTAFFLCCLREPPPVYPDLAEVV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 390916 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title