missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Oxytocin/Neurophysin I Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68928-25ul
This item is not returnable.
View return policy
Description
Oxytocin/Neurophysin I Polyclonal antibody specifically detects Oxytocin/Neurophysin I in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Oxytocin/Neurophysin I | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| neurophysin I, OT, OT-NPI, OXT, OXT-NPI, oxytocin, prepro- (neurophysin I), oxytocin, prepropeptide, oxytocin-neurophysin 1, oxytocin-neurophysin I, preproprotein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS | |
| 25 μL | |
| Neuroscience | |
| 5020 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction