missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Oxytocin/Neurophysin I Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 559.00
Specifications
| Antigen | Oxytocin/Neurophysin I |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18673297
|
Novus Biologicals
NBP2-68928-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635938
|
Novus Biologicals
NBP2-68928 |
100 μg |
€ 559.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Oxytocin/Neurophysin I Polyclonal antibody specifically detects Oxytocin/Neurophysin I in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Oxytocin/Neurophysin I | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol | |
| 5020 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| neurophysin I, OT, OT-NPI, OXT, OXT-NPI, oxytocin, prepro- (neurophysin I), oxytocin, prepropeptide, oxytocin-neurophysin 1, oxytocin-neurophysin I, preproprotein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title