missing translation for 'onlineSavingsMsg'
Learn More

ARL2BP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-98397

View more versions of this product

Product Code. 18069586

€ 483.00 / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ARL2BP Polyclonal specifically detects ARL2BP in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	ARL2BP
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias	ADP-ribosylation factor-like 2 binding protein, ADP-ribosylation factor-like protein 2-binding protein, ARF-like 2-binding protein, BART1binder of Arl Two, BARTArf-like 2 binding protein BART1, Binder of ARF2 protein 1, binder of Arl2
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	23568
Target Species	Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Isotype	IgG

Applications	Western Blot
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml
Gene Accession No.	Q9D385
Gene Symbols	ARL2BP
Immunogen	Synthetic peptide corresponding to mouse Arl2bp - C-terminal region (NP_077231). Peptide Sequence: LQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVT
Quantity	100 μL
Primary or Secondary	Primary
Reconstitution	Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

ARL2BP Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions