missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2X6/P2RX6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | P2X6/P2RX6 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18697886
|
Novus Biologicals
NBP2-48584-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18680497
|
Novus Biologicals
NBP2-48584 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
P2X6/P2RX6 Polyclonal antibody specifically detects P2X6/P2RX6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| P2X6/P2RX6 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology, Neuroscience, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 9127 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ATP receptor, MGC129625, P2RXL1skeletal muscle-expressed P2X, P2X purinoceptor 6, P2X6purinoceptor P2X6, P2XMpurinoreceptor P2X6, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 6, Purinergic receptor P2X-like 1, purinergic receptor P2X-like 1, orphan receptor | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLAN | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title