missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PABPC1L2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54693-25ul
This item is not returnable.
View return policy
Description
PABPC1L2A Polyclonal specifically detects PABPC1L2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PABPC1L2A | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| MGC168104, PABPC1L2, PABPC1L2B, poly(A) binding protein, cytoplasmic 1-like 2A, polyadenylate-binding protein 1-like 2, RBM32A, RBM32B, RNA binding motif protein 32A, RNA-binding motif protein 32, RNA-binding protein 32 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| PABPC1L2A | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR | |
| 25 μL | |
| metabolism | |
| 340529 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction