missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PABPC1L2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | PABPC1L2A |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18117309
|
Novus Biologicals
NBP2-54693 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615336
|
Novus Biologicals
NBP2-54693-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PABPC1L2A Polyclonal specifically detects PABPC1L2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PABPC1L2A | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 340529 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| MGC168104, PABPC1L2, PABPC1L2B, poly(A) binding protein, cytoplasmic 1-like 2A, polyadenylate-binding protein 1-like 2, RBM32A, RBM32B, RNA binding motif protein 32A, RNA-binding motif protein 32, RNA-binding protein 32 | |
| PABPC1L2A | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title