missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Parkin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68629-25ul
This item is not returnable.
View return policy
Description
Parkin Polyclonal antibody specifically detects Parkin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Parkin | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| E3 ubiquitin ligase, E3 ubiquitin-protein ligase parkin, EC 6.3.2.-, LPRS2, parkin, parkin 2, Parkinson disease protein 2, Parkinson juvenile disease protein 2, parkinson protein 2, E3 ubiquitin protein ligase (parkin), PDJjuvenile) 2, parkin | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS | |
| 25 μL | |
| Alzheimers Research, Neurodegeneration, Neuronal Cell Markers, Neuroscience | |
| 5071 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction