missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Parkin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 379.00 - € 500.00
Specifications
| Antigen | Parkin |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18646718
|
Novus Biologicals
NBP2-68629-25ul |
25 μL |
€ 379.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18685206
|
Novus Biologicals
NBP2-68629 |
100 μg |
€ 500.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Parkin Polyclonal antibody specifically detects Parkin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Parkin | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Alzheimers Research, Neurodegeneration, Neuronal Cell Markers, Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol | |
| 5071 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| E3 ubiquitin ligase, E3 ubiquitin-protein ligase parkin, EC 6.3.2.-, LPRS2, parkin, parkin 2, Parkinson disease protein 2, Parkinson juvenile disease protein 2, parkinson protein 2, E3 ubiquitin protein ligase (parkin), PDJjuvenile) 2, parkin | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title