missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEG10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48592
This item is not returnable.
View return policy
Description
PEG10 Polyclonal antibody specifically detects PEG10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| PEG10 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| embryonal carcinoma differentiation regulated, Embryonal carcinoma differentiation-regulated protein, HB-1, KIAA1051EDR, Mammalian retrotransposon-derived protein 2, Mar2, Mart2, MEF3 like 1, MEF3L, MEF3L1, Myelin expression factor 3-like protein 1, paternally expressed 10, Paternally expressed gene 10 protein, retrotransposon gag domain containing 3, Retrotransposon gag domain-containing protein 3, Retrotransposon-derived gag-like polyprotein, retrotransposon-derived protein PEG10, RGAG3MEF3-like protein 1, Ty3/Gypsy-like protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LVDPHIEMIPGAHSIPSGHVYSLSEPEMAALRDFVARNVKDGLITPTIAPNGAQVLQVKRGWKLQVSYDCRAPNNFTIQNQYPR | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 23089 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction