missing translation for 'onlineSavingsMsg'
Learn More

PGAM5 Antibody (CL0624), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals NBP2-52947-25ul

View more versions of this product

Product Code. 18603357

€ 280.00 / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PGAM5 Monoclonal antibody specifically detects PGAM5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen	PGAM5
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), 40% Glycerol
Host Species	Mouse
Purification Method	Protein A purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Clone	CL0624
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated
Gene Alias	Bcl-XL-binding protein v68, BXLBv68, EC 3.1.3.16, MGC5352, phosphoglycerate mutase family member 5BXLBV68, serine/threonine-protein phosphatase PGAM5, mitochondrial
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Quantity	25 μL
Research Discipline	Signal Transduction
Gene ID (Entrez)	192111
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG1

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

PGAM5 Antibody (CL0624), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions