missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGAM5 Antibody (CL0624), Novus Biologicals™
Mouse Monoclonal Antibody
€ 280.00 - € 572.00
Specifications
| Antigen | PGAM5 |
|---|---|
| Clone | CL0624 |
| Dilution | Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18603357
|
Novus Biologicals
NBP2-52947-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18659648
|
Novus Biologicals
NBP2-52947 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PGAM5 Monoclonal antibody specifically detects PGAM5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDownSpecifications
| PGAM5 | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| Bcl-XL-binding protein v68, BXLBv68, EC 3.1.3.16, MGC5352, phosphoglycerate mutase family member 5BXLBV68, serine/threonine-protein phosphatase PGAM5, mitochondrial | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| CL0624 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| Mouse | |
| Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 192111 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title