missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGRMC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 13 publications
€ 415.00 - € 518.00
Specifications
| Antigen | PGRMC1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500-1:1000, KnockDown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18488630
|
Novus Biologicals
NBP1-83220-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18717173
|
Novus Biologicals
NBP1-83220 |
€ 518.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
PGRMC1 Polyclonal specifically detects PGRMC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| PGRMC1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| HPR6.6PGRMC, membrane-associated progesterone receptor component 1, MPR, progesterone binding protein, progesterone receptor membrane component 1 | |
| PGRMC1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human PGRMC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/mL, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500-1:1000, KnockDown Validated | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10857 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title