missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Phospholamban Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94385-0.1ml
This item is not returnable.
View return policy
Description
Phospholamban Polyclonal antibody specifically detects Phospholamban in Mouse, Rat samples. It is validated for Western Blot
Specifications
| Phospholamban | |
| Polyclonal | |
| Western Blot 1:100 - 1:500 | |
| CMD1PPLBcardiac phospholamban, phospholamban | |
| A synthetic peptide corresponding to a sequence within amino acids 1-52 of human Phospholamban (NP_002658.1). MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL | |
| 0.1 mL | |
| Signal Transduction | |
| 5350 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction