missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Phospholamban Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 221.00 - € 470.00
Specifications
| Antigen | Phospholamban |
|---|---|
| Dilution | Western Blot 1:100 - 1:500 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18676842
|
Novus Biologicals
NBP2-94385-0.02ml |
0.02 mL |
€ 221.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18688432
|
Novus Biologicals
NBP2-94385-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Phospholamban Polyclonal antibody specifically detects Phospholamban in Mouse, Rat samples. It is validated for Western BlotSpecifications
| Phospholamban | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 5350 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| CMD1PPLBcardiac phospholamban, phospholamban | |
| A synthetic peptide corresponding to a sequence within amino acids 1-52 of human Phospholamban (NP_002658.1). MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title