missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PI 3-Kinase p110 gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57013
This item is not returnable.
View return policy
Description
PI 3-Kinase p110 gamma Polyclonal specifically detects PI 3-Kinase p110 gamma in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| PI 3-Kinase p110 gamma | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| 1-phosphatidylinositol 3-kinase, EC 2.7.1, EC 2.7.1.153, p110-gamma, p120-PI3K, phosphatidylinositol 3 kinase gamma, p110 gamma, phosphatidylinositol 3-kinase catalytic 110-kD gamma, phosphatidylinositol 3-kinase, catalytic, gamma polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, phosphoinositide-3-kinase gamma catalytic subunit, phosphoinositide-3-kinase, catalytic, gamma polypeptide, PI3CG, PI3K, PI3Kgamma, PI3K-gamma, PI3-kinase subunit gamma, PIK3, PtdIns-3-kinase subunit gamma, PtdIns-3-kinase subunit p110-gamma | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| PIK3CG | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT | |
| 100 μL | |
| mTOR Pathway, Signal Transduction | |
| 5294 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction