missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PI 3-Kinase p110 gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 498.00
Specifications
| Antigen | PI 3-Kinase p110 gamma |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18200875
|
Novus Biologicals
NBP2-57013 |
100 μL |
€ 498.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18688536
|
Novus Biologicals
NBP2-57013-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PI 3-Kinase p110 gamma Polyclonal specifically detects PI 3-Kinase p110 gamma in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PI 3-Kinase p110 gamma | |
| Polyclonal | |
| Rabbit | |
| mTOR Pathway, Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5294 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1-phosphatidylinositol 3-kinase, EC 2.7.1, EC 2.7.1.153, p110-gamma, p120-PI3K, phosphatidylinositol 3 kinase gamma, p110 gamma, phosphatidylinositol 3-kinase catalytic 110-kD gamma, phosphatidylinositol 3-kinase, catalytic, gamma polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, phosphoinositide-3-kinase gamma catalytic subunit, phosphoinositide-3-kinase, catalytic, gamma polypeptide, PI3CG, PI3K, PI3Kgamma, PI3K-gamma, PI3-kinase subunit gamma, PIK3, PtdIns-3-kinase subunit gamma, PtdIns-3-kinase subunit p110-gamma | |
| PIK3CG | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title