missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PKC iota Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58629
This item is not returnable.
View return policy
Description
PKC iota Polyclonal specifically detects PKC iota in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| PKC iota | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| aPKC-lambda/iota, Atypical protein kinase C-lambda/iota, DXS1179E, EC 2.7.11, EC 2.7.11.13, MGC26534, nPKC-iota, PKCI, PRKC-lambda/iota, protein kinase C iota type, protein kinase C, iota | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| PRKCI | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLEL | |
| 100 μL | |
| Protein Kinase, Signal Transduction | |
| 5584 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction