missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PKC iota Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 529.00
Specifications
| Antigen | PKC iota |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18219273
|
Novus Biologicals
NBP2-58629 |
100 μL |
€ 529.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643688
|
Novus Biologicals
NBP2-58629-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PKC iota Polyclonal specifically detects PKC iota in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PKC iota | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase, Signal Transduction | |
| aPKC-lambda/iota, Atypical protein kinase C-lambda/iota, DXS1179E, EC 2.7.11, EC 2.7.11.13, MGC26534, nPKC-iota, PKCI, PRKC-lambda/iota, protein kinase C iota type, protein kinase C, iota | |
| PRKCI | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5584 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLEL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title