missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMM2/Phosphomannomutase 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85716
This item is not returnable.
View return policy
Description
PMM2/Phosphomannomutase 2 Polyclonal antibody specifically detects PMM2/Phosphomannomutase 2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| PMM2/Phosphomannomutase 2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL | |
| CDG1, CDG1A, CDGS, EC 5.4.2.8, phosphomannomutase 2, PMM 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS | |
| 0.1 mL | |
| Lipid and Metabolism | |
| 5373 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction