missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMM2/Phosphomannomutase 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 792.00
Specifications
| Antigen | PMM2/Phosphomannomutase 2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18487730
|
Novus Biologicals
NBP1-85716 |
0.1 mL |
€ 792.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18412801
|
Novus Biologicals
NBP1-85716-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PMM2/Phosphomannomutase 2 Polyclonal antibody specifically detects PMM2/Phosphomannomutase 2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| PMM2/Phosphomannomutase 2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol | |
| 5373 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CDG1, CDG1A, CDGS, EC 5.4.2.8, phosphomannomutase 2, PMM 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title