missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58368-25ul
This item is not returnable.
View return policy
Description
PMS1 Polyclonal specifically detects PMS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| PMS1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| DKFZp781M0253, FLJ98259, HNPCC3, hPMS1, human homolog of yeast mutL, mismatch repair gene PMSL1, PMS1 postmeiotic segregation increased 1 (S. cerevisiae), PMS1 protein homolog 1, PMSL1DNA mismatch repair protein PMS1, postmeiotic segregation increased (S. cerevisiae) 1, rhabdomyosarcoma antigen MU-RMS-40.10B, rhabdomyosarcoma antigen MU-RMS-40.10E | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| PMS1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSS | |
| 25 μL | |
| DNA Repair, Mismatch Repair, Ovarian Carcinoma Cell Markers | |
| 5378 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction