missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00
Specifications
| Antigen | PMS1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PMS1 Polyclonal specifically detects PMS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PMS1 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Mismatch Repair, Ovarian Carcinoma Cell Markers | |
| DKFZp781M0253, FLJ98259, HNPCC3, hPMS1, human homolog of yeast mutL, mismatch repair gene PMSL1, PMS1 postmeiotic segregation increased 1 (S. cerevisiae), PMS1 protein homolog 1, PMSL1DNA mismatch repair protein PMS1, postmeiotic segregation increased (S. cerevisiae) 1, rhabdomyosarcoma antigen MU-RMS-40.10B, rhabdomyosarcoma antigen MU-RMS-40.10E | |
| PMS1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5378 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title