missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POLR3D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49530
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
POLR3D Polyclonal antibody specifically detects POLR3D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifica
| POLR3D | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| BN51, BN51 (BHK21) temperature sensitivity complementing, BN51TDNA-directed RNA polymerase III 47 kDa polypeptide, DNA-directed RNA polymerase III subunit D, DNA-directed RNA polymerase III subunit RPC4, polymerase (RNA) III (DNA directed) polypeptide D, 44kDa, Protein BN51, RNA polymerase III 47 kDa subunit, RNA polymerase III subunit C4, RPC4, RPC53 homolog, temperature sensitive complementation, cell cycle specific, tsBN51, TSBN51RPC53 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQE | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 661 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto