missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PORCN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35234-100ul
This item is not returnable.
View return policy
Description
PORCN Polyclonal antibody specifically detects PORCN in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| PORCN | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| 2410004O13Rik, DHOF, EC 2.3.1.-, FODH, MG61PPNprobable protein-cysteine N-palmitoyltransferase porcupine, por, PORCMGC29687, porcupine homolog (Drosophila), Protein MG61 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1).,, Sequence:, PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG | |
| 100 μL | |
| Stem Cells | |
| 64840 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction