missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PORCN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 201.00 - € 550.00
Specifications
| Antigen | PORCN |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226917
|
Novus Biologicals
NBP3-35234-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231872
|
Novus Biologicals
NBP3-35234-20ul |
20 μL |
€ 201.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PORCN Polyclonal antibody specifically detects PORCN in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| PORCN | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Stem Cells | |
| PBS (pH 7.3), 50% glycerol | |
| 64840 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| 2410004O13Rik, DHOF, EC 2.3.1.-, FODH, MG61PPNprobable protein-cysteine N-palmitoyltransferase porcupine, por, PORCMGC29687, porcupine homolog (Drosophila), Protein MG61 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1).,, Sequence:, PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title