missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38812-25ul
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
PP5 Polyclonal specifically detects PP5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| PP5 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P53041 | |
| PPP5C | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM | |
| 25 μL | |
| Cell Cycle and Replication | |
| 5536 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.1.3.16, PP5FLJ36922, PPP5, PPT, PP-T, protein phosphatase 5, catalytic subunit, Protein phosphatase T, Serine/Threonine phosphatase, serine/threonine-protein phosphatase 5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering