missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 560.70
Specifications
| Antigen | PP5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18604755
|
Novus Biologicals
NBP2-38812-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18106888
|
Novus Biologicals
NBP2-38812 |
0.1 mL |
€ 593.00 € 560.70 / 0.10mL Save € 32.30 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PP5 Polyclonal specifically detects PP5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PP5 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.1.3.16, PP5FLJ36922, PPP5, PPT, PP-T, protein phosphatase 5, catalytic subunit, Protein phosphatase T, Serine/Threonine phosphatase, serine/threonine-protein phosphatase 5 | |
| PPP5C | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P53041 | |
| 5536 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title