missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRKCDBP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35738-20ul
This item is not returnable.
View return policy
Description
PRKCDBP Polyclonal antibody specifically detects PRKCDBP in Rat samples. It is validated for ELISA,Western Blot
Specifications
| PRKCDBP | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| Cavin-3, hSRBC, MGC20400, protein kinase C, delta binding protein, sdr-related gene product that binds to c-kinase, Serum deprivation response factor-related gene product that binds to C-kinase, SRBCprotein kinase C delta-binding protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 75-160 of human PRKCDBP (NP_659477.2).,, Sequence:, SNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEA | |
| 20 μL | |
| Diabetes Research, Lipid and Metabolism | |
| 112464 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction