missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRKCDBP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | PRKCDBP |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226685
|
Novus Biologicals
NBP3-35738-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230290
|
Novus Biologicals
NBP3-35738-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PRKCDBP Polyclonal antibody specifically detects PRKCDBP in Rat samples. It is validated for ELISA,Western BlotSpecifications
| PRKCDBP | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Diabetes Research, Lipid and Metabolism | |
| PBS (pH 7.3), 50% glycerol | |
| 112464 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Rat | |
| Cavin-3, hSRBC, MGC20400, protein kinase C, delta binding protein, sdr-related gene product that binds to c-kinase, Serum deprivation response factor-related gene product that binds to C-kinase, SRBCprotein kinase C delta-binding protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 75-160 of human PRKCDBP (NP_659477.2).,, Sequence:, SNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title