missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRL-2/PTP4A2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93937-0.02ml
This item is not returnable.
View return policy
Description
PRL-2/PTP4A2 Polyclonal antibody specifically detects PRL-2/PTP4A2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| PRL-2/PTP4A2 | |
| Polyclonal | |
| Western Blot 1:200-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| EC 3.1.3.48, HU-PP-1HH13, OV-1PTP4A, PRL-2HH7-2, PRL2protein tyrosine phosphatase IVA, protein tyrosine phosphatase IVA2, protein tyrosine phosphatase type IVA 2, protein tyrosine phosphatase type IVA, member 2, Protein-tyrosine phosphatase 4a2, Protein-tyrosine phosphatase of regenerating liver 2, PTP(CAAXII), PTPCAAX2phosphatase of regenerating liver 2, ptp-IV1a, ptp-IV1b | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human PTP4A2 (NP_536316.1). FTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVH | |
| 0.02 mL | |
| Cancer, Cell Biology, Cell Cycle and Replication, Signal Transduction | |
| 8073 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction