missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRL-2/PTP4A2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 201.00 - € 470.00
Specifications
| Antigen | PRL-2/PTP4A2 |
|---|---|
| Dilution | Western Blot 1:200-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18683730
|
Novus Biologicals
NBP2-93937-0.02ml |
0.02 mL |
€ 201.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18617681
|
Novus Biologicals
NBP2-93937-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PRL-2/PTP4A2 Polyclonal antibody specifically detects PRL-2/PTP4A2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| PRL-2/PTP4A2 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Cell Cycle and Replication, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 8073 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 3.1.3.48, HU-PP-1HH13, OV-1PTP4A, PRL-2HH7-2, PRL2protein tyrosine phosphatase IVA, protein tyrosine phosphatase IVA2, protein tyrosine phosphatase type IVA 2, protein tyrosine phosphatase type IVA, member 2, Protein-tyrosine phosphatase 4a2, Protein-tyrosine phosphatase of regenerating liver 2, PTP(CAAXII), PTPCAAX2phosphatase of regenerating liver 2, ptp-IV1a, ptp-IV1b | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human PTP4A2 (NP_536316.1). FTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title