missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSD93 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58558
This item is not returnable.
View return policy
Description
PSD93 Polyclonal specifically detects PSD93 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| PSD93 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| Chapsyn-110, discs, large homolog 2 (Drosophila), discs, large homolog 2, chapsyn-110, discs, large homolog 2, chapsyn-110 (Drosophila), disks large homolog 2, DKFZp781D1854, DKFZp781E0954, FLJ37266, MGC131811, Postsynaptic density protein PSD-93, PSD-93, PSD93,110kDa | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerols with 0.02% Sodium Azide | |
| DLG2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI | |
| 100 μL | |
| Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision | |
| 1740 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto