missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSD93 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 540.75
Specifications
| Antigen | PSD93 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18299262
|
Novus Biologicals
NBP2-58558 |
100 μL |
€ 572.00 € 540.75 / 100µL Save € 31.25 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18685806
|
Novus Biologicals
NBP2-58558-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSD93 Polyclonal specifically detects PSD93 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| PSD93 | |
| Polyclonal | |
| Rabbit | |
| Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision | |
| Chapsyn-110, discs, large homolog 2 (Drosophila), discs, large homolog 2, chapsyn-110, discs, large homolog 2, chapsyn-110 (Drosophila), disks large homolog 2, DKFZp781D1854, DKFZp781E0954, FLJ37266, MGC131811, Postsynaptic density protein PSD-93, PSD-93, PSD93,110kDa | |
| DLG2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1740 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title