missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSD93 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58558-25ul
This item is not returnable.
View return policy
Description
PSD93 Polyclonal specifically detects PSD93 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| PSD93 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| Chapsyn-110, discs, large homolog 2 (Drosophila), discs, large homolog 2, chapsyn-110, discs, large homolog 2, chapsyn-110 (Drosophila), disks large homolog 2, DKFZp781D1854, DKFZp781E0954, FLJ37266, MGC131811, Postsynaptic density protein PSD-93, PSD-93, PSD93,110kDa | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| DLG2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI | |
| 25 μL | |
| Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision | |
| 1740 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido