missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSMA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38894
This item is not returnable.
View return policy
Description
PSMA4 Polyclonal specifically detects PSMA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PSMA4 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P25789 | |
| PSMA4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTR | |
| 0.1 mL | |
| Proteases & Other Enzymes | |
| 5685 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HC9EC 3.4.25.1, HsT17706, Macropain subunit C9, MGC12467, MGC24813, Multicatalytic endopeptidase complex subunit C9, proteasome (prosome, macropain) subunit, alpha type, 4, Proteasome component C9, proteasome subunit alpha type-4, proteasome subunit HC9, Proteasome subunit L, PSC9MGC111191 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction