missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSMA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | PSMA4 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18663736
|
Novus Biologicals
NBP2-38894-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18168578
|
Novus Biologicals
NBP2-38894 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSMA4 Polyclonal specifically detects PSMA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PSMA4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P25789 | |
| 5685 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Proteases & Other Enzymes | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HC9EC 3.4.25.1, HsT17706, Macropain subunit C9, MGC12467, MGC24813, Multicatalytic endopeptidase complex subunit C9, proteasome (prosome, macropain) subunit, alpha type, 4, Proteasome component C9, proteasome subunit alpha type-4, proteasome subunit HC9, Proteasome subunit L, PSC9MGC111191 | |
| PSMA4 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title