missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSORS1C1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05672-100ul
This item is not returnable.
View return policy
Description
PSORS1C1 Polyclonal antibody specifically detects PSORS1C1 in Human samples. It is validated for Western Blot
Specifications
| PSORS1C1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| C6orf16, PSORS1C1 psoriasis susceptibility 1 candidate 1, SEEK1 | |
| A synthetic peptide corresponding to a sequence within amino acids 40-100 of human PSORS1C1 (NP_054787.2). HVNPDRLCHMEPANHFWHAGDLQAMISKEFHLAATQDDCRKGRTQEDILVPSSHPELFASV | |
| 100 μg | |
| Cell Biology | |
| 170679 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction