missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSORS1C1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 196.00 - € 462.00
Specifications
| Antigen | PSORS1C1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PSORS1C1 Polyclonal antibody specifically detects PSORS1C1 in Human samples. It is validated for Western BlotSpecifications
| PSORS1C1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS with 50% glycerol, pH7.3. | |
| 170679 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| C6orf16, PSORS1C1 psoriasis susceptibility 1 candidate 1, SEEK1 | |
| A synthetic peptide corresponding to a sequence within amino acids 40-100 of human PSORS1C1 (NP_054787.2). HVNPDRLCHMEPANHFWHAGDLQAMISKEFHLAATQDDCRKGRTQEDILVPSSHPELFASV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title