missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTHLH/PTHrP Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94123-0.02ml
This item is not returnable.
View return policy
Description
PTHLH/PTHrP Polyclonal antibody specifically detects PTHLH/PTHrP in Human samples. It is validated for Western Blot
Specifications
| PTHLH/PTHrP | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| BDE2, HHM, MGC14611, parathyroid hormone-like hormone, Parathyroid hormone-like protein, parathyroid hormone-related protein, PLPosteostatin, PTHR, PTH-related protein, PTHrP, PTH-rP, PTHRPparathyroid hormone-like related protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 74-130 of human PTHLH (NP_945316.1). ATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKP | |
| 0.02 mL | |
| Biologically Active Proteins, Cell Cycle and Replication | |
| 5744 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction