missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTHLH/PTHrP Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 470.00
Specifications
| Antigen | PTHLH/PTHrP |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18600282
|
Novus Biologicals
NBP2-94123-0.02ml |
0.02 mL |
€ 188.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625192
|
Novus Biologicals
NBP2-94123-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PTHLH/PTHrP Polyclonal antibody specifically detects PTHLH/PTHrP in Human samples. It is validated for Western BlotSpecifications
| PTHLH/PTHrP | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Biologically Active Proteins, Cell Cycle and Replication | |
| PBS (pH 7.3), 50% glycerol | |
| 5744 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BDE2, HHM, MGC14611, parathyroid hormone-like hormone, Parathyroid hormone-like protein, parathyroid hormone-related protein, PLPosteostatin, PTHR, PTH-related protein, PTHrP, PTH-rP, PTHRPparathyroid hormone-like related protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 74-130 of human PTHLH (NP_945316.1). ATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title