missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAB12 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93258-0.02ml
This item is not returnable.
View return policy
Description
RAB12 Polyclonal antibody specifically detects RAB12 in Human, Mouse samples. It is validated for Western Blot
Specifications
| RAB12 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FLJ45927, MGC104724, putative Ras-related protein Rab-12, RAB12, member RAS oncogene family, ras-related protein Rab-12 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RAB12 (NP_001020471.2). MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA | |
| 0.02 mL | |
| GPCR, Signal Transduction | |
| 201475 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction