missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAB12 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 468.00
Specifications
| Antigen | RAB12 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RAB12 Polyclonal antibody specifically detects RAB12 in Human, Mouse samples. It is validated for Western BlotSpecifications
| RAB12 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 201475 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| FLJ45927, MGC104724, putative Ras-related protein Rab-12, RAB12, member RAS oncogene family, ras-related protein Rab-12 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RAB12 (NP_001020471.2). MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title