missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RASSF8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38395
This item is not returnable.
View return policy
Description
RASSF8 Polyclonal specifically detects RASSF8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| RASSF8 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q8NHQ8 | |
| RASSF8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TEFKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLEQKIKRNDVEIEEEEFWENELQIE | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C12orf2, carcinoma associated HOJ-1, Carcinoma-associated protein HOJ-1, chromosome 12 open reading frame 2, DKFZp434O0227, FLJ11542, HoJ-1, HOJ1, Ras association (RalGDS/AF-6) domain family (N-terminal) member 8, ras association domain-containing protein 8 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 11228 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction