missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RASSF8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | RASSF8 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18657315
|
Novus Biologicals
NBP2-38395-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18142348
|
Novus Biologicals
NBP2-38395 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RASSF8 Polyclonal specifically detects RASSF8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RASSF8 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C12orf2, carcinoma associated HOJ-1, Carcinoma-associated protein HOJ-1, chromosome 12 open reading frame 2, DKFZp434O0227, FLJ11542, HoJ-1, HOJ1, Ras association (RalGDS/AF-6) domain family (N-terminal) member 8, ras association domain-containing protein 8 | |
| RASSF8 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8NHQ8 | |
| 11228 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TEFKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLEQKIKRNDVEIEEEEFWENELQIE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title