missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBFOX3/NeuN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21393-25ul
This item is not returnable.
View return policy
Description
RBFOX3/NeuN Polyclonal antibody specifically detects RBFOX3/NeuN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| RBFOX3/NeuN | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| FLJ56884, FLJ58356, Fox-1 homolog C, FOX3, FOX-3, hexaribonucleotide binding protein 3, HRNBP3, NeuN, neuN antigen, neuronal nuclei, neuronal nuclei antigen, RBFOX3, RNA binding protein fox-1 homolog 3, RNA binding protein, fox-1 homolog (C. elegans) 3, RNA binding protein, fox-1 homolog 3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS | |
| 25 μg | |
| DNA replication Transcription Translation and Splicing, Neuronal Cell Markers, Neuroscience | |
| 146713 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction