missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBFOX3/NeuN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 425.25 - € 668.85
Specifications
| Antigen | RBFOX3/NeuN |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18641934
|
Novus Biologicals
NBP3-21393-25ul |
25 μg |
€ 450.00 € 425.25 / 25µL Save € 24.75 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18630664
|
Novus Biologicals
NBP3-21393-100ul |
100 μg |
€ 708.00 € 668.85 / 100µL Save € 39.15 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RBFOX3/NeuN Polyclonal antibody specifically detects RBFOX3/NeuN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| RBFOX3/NeuN | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing, Neuronal Cell Markers, Neuroscience | |
| PBS, pH 7.2, 40% glycerol | |
| 146713 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ56884, FLJ58356, Fox-1 homolog C, FOX3, FOX-3, hexaribonucleotide binding protein 3, HRNBP3, NeuN, neuN antigen, neuronal nuclei, neuronal nuclei antigen, RBFOX3, RNA binding protein fox-1 homolog 3, RNA binding protein, fox-1 homolog (C. elegans) 3, RNA binding protein, fox-1 homolog 3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title